Sign In | Join Free | My benadorassociates.com
benadorassociates.com
Products
Search by Category

sermorelin buy online

All sermorelin buy online wholesalers & sermorelin buy online manufacturers come from members. We doesn't provide sermorelin buy online products or service, please contact them directly and verify their companies info carefully.

Total 114 products from sermorelin buy online Manufactures & Suppliers
Quality 99% Purity Sermorelin Acetate Muscle Building Peptides Sermorelin CAS 86168-78-7 GRF 1-29 for sale

Brand Name:TINGYI

Model Number:CAS: 86168-78-7

Place of Origin:China

...Abstract Sermorelin Sermorelin, also known as GRF 1-29, is a synthetic peptide belonging to Hormone Releasing Hormone. Sermorelin Acetate is a truncated analog of a hormone releasing factor (GRF 1-44) that is naturally produced by ...

Chongqing Tingyi Biotechnology Co.,Ltd
Verified Supplier

Chongqing

Quality Australia Very Very Discreet Package 1,4-Butanediol 1,4 BDO,Colorless Liquid Tire Clearner 1,4-Butanediol CAS 110-63-4 for sale

Brand Name:YC

Model Number:CAS 110-63-4

Place of Origin:China

1,4 Butanediol Detail Product Name 1,4-Butanediol;1,4-Dihydroxybutane;1,4-Butylene glycol;Tetramethylene glycol CAS NO. 110-63-4 EINECS NO. 203-786-5 MF C4H10O2 PURITY 99% APPEARANCE colorless viscous liquid MELTING POINT 20℃ BOILING POINT 230℃ Flash ...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Quality Pharmaceutical Grade Muscle Gaining Triptorelin/Triptorelin Acetate Human Growth Hormone CAS 57773-63-4 for sale

Brand Name:Saichuang

Model Number:57773-63-4

Place of Origin:China

Pharmaceutical Grade Muscle Gaining Triptorelin/Triptorelin Acetate Human Growth Hormone CAS 57773-63-4 Quick Details Product Name: Triptorelin Packing: 1. 2mg/vial, 10vial/box, bulk aluminum foil bag or on request 2. 5mg/vial, 10vial/box, bulk aluminum ...

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

Quality Healing Injuries Muscle Building Peptides 99% Purity Human PeptidesTB - 500 Thymosin Beta 4 Acetate Freeze-dried Powder for sale

Place of Origin:China

Brand Name:Muscle Building Peptides

Model Number:Muscle Building Peptides

Description: TB-500 is a synthetic fraction of the protein thymosin beta-4, which is present in virtually all human and animal cells. The main purpose of this peptide is to promote healing. It also promotes creation of new blood and muscle cells. The ...

Guangzhou Lishen Healthcare Co.,Ltd
Verified Supplier

Guangdong

Quality High Purity Injectable Human Growth Peptides Hormones Adipotide 2mg / Vial for sale

Brand Name:YIHAN

Model Number:adipotide

Place of Origin:CHINA

High Purity Injectable Human Growth Peptides Hormones Adipotide 2mg / Vial Quick detail: Product Name adipotide CAS no 137525-51-0 Molecular Formula C111h204n36o28s2 Appearance White powder Packing 1box/10vials,2mg/vial Application Pharmaceutical raw ...

Yihan Industrial Co.,Ltd.
Verified Supplier

Guangdong

Quality Testosterone Sustanon 250 Testosterone Anabolic Steroid For Muscle Building for sale

Brand Name:Pharmlab

Model Number:/

Place of Origin:China

... All Country Guarantee: Support Re-Sending Police Payment: Western Union, Money Gram, Bitcoin, Paypal, T/T Gift: Buy One Get One Free Sample: Available Shipping Time: Process Order Within 12hours Shipping Method: Hkems...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Quality Human Growth Male Enhancement Powders Peptide HGH 176-191 HGH Fragment Somatotropin for sale

Brand Name:Nanjian

Model Number:12629-01-5

Place of Origin:China mainland

Human Growth Hormone Peptide 2mg/vial HGH 176-191 HGH Fragment Somatotropin Quick details: Product Name: HGH 176-191, GROWTH HORMONE, HUMAN Synonyms: cb311;crecormon;humatrope;ly137998;norditropin;sj0011;OVINE SOMATOTROPIN;SOMATOTROPIN CAS: 12629-01-5 MF:...

Shenzhen Haiwen Biotechnology Co.,Ltd
Verified Supplier

Guangdong

Quality Cycle Raw Steroid Powders Testosterone Enanthate Results For Muscle Mass for sale

Brand Name:HONGKONG YUANCHENG

Model Number:RAW STEROID POWDER

Place of Origin:HUBEI,CHINA

Cycle Raw Steroid Powders Testosterone Enanthate Results For Muscle Mass Product Name:Testosterone Enanthate Alias: Primoteston Depot,Testosterone Enishhingested,testoviron depot,Testosterone heptanoate CAS NO: 315-37-7 Einecs No: 206-253-5 Molecular ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Quality Anabolic Androgenic Steroids Testosterone Undecanoate Andriol CAS 5949-44-0 for sale

Brand Name:YIHAN

Model Number:Testosterone Undecanoate

Place of Origin:China

Anabolic Androgenic Steroids Testosterone Undecanoate Andriol CAS 5949-44-0 1. Brief Introduction: Testosterone undecanoate or testosterone undecylate is an ester of testosterone. This hormone is used in androgen replacement therapy primarily for the ...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Quality Promoting Healing TB 500 Protein Peptide Growth Hormone Thymosin Beta for sale

Brand Name:Bodybiological

Model Number:TB 500

Place of Origin:Hubei, China

Promoting Healing TB 500, 5mg/vial, 100% Safe to Brazil Protein Peptide Hormones Basic Info: Tb-500 (Thymosin Beta) 2mg/Vial 5mg/Vial We also sell our peptides in small vials. The price can be negotiated. Professional service, fast and safe shipment, ...

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

Quality High standard Raw Steroid Testosterone Decanoate Body Growth for Gain Muscle for sale

Brand Name:HKB

Model Number:5721-91-5

Place of Origin:China

High standard Raw Steroid Testosterone Decanoate Body Growth for Gain Muscle Basic Inf: CAS: 5721-91-5 Character: White crystalline powder. EINECS: 227-226-4 Mocular Formula: C29H46O3 Mocular weight:442.68 Assay: 99%. Boiling point:539.2°C Refractive ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Quality Muscle Building Steroids CAS 5949-44-0 Testosterone Undecanoate Raw Steroid 99% High Pure For Bodybuilding for sale

Brand Name:SGH

Model Number:5949-44-0

Place of Origin:China

... -20°C Freezer Appearance: White Solid Where to buy raw steroid powders testosterone undecanoate muscle mass steroids online Buy raw steroid powders testosterone undecanoate muscle mass steroids Online from lianshangwang Testosterone undecanoate powder is...

Jiangsu Biostronger Technology Co.,Ltd
Verified Supplier

Jiangsu

Quality CAS 1379686-30-2 SR9009 Bodybuilding Sarms Steroids 99% Purity White Powder for sale

Brand Name:SR9009

Model Number:Powder

Place of Origin:China

...SR9009 Dosage SR9009 Review SR9009 For Sale Buy SR9009 Online SR9009 Results Quick details: Chemical name: Sr9009 from SARMS Endurance Improving Sr9009 Related: SR9009 , SR9009 ...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Quality CAS 50-56-6 Growth Hormone Peptides Polypeptide Hormone Oxytocin for Hasten Parturition for sale

Brand Name:Kafen

Model Number:50-56-6

Place of Origin:China

Muscle Growth Steriods Polypeptide Hormone Oxytocin for Hasten Parturition CAS:50-56-6 Basic info. Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. : 50-56-6 Synonyms :Oxytocin acetate salt hydrate, Ocytocinum, and Alpha-Hypophamine Molecular Formula : ...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Quality High purity competitive price Oral Injectable Anabolic Steroid Hormone l triiodothyronine T3 CAS 55-06-1 for sale

Brand Name:Sodium L-Triiodothyronine(T3)

Model Number:Sodium L-Triiodothyronine(T3)

Place of Origin:China

High Quality L-Triiodothyronine (T3) Powder CAS 55-06-1 Liothyronine Sodium Thyroid Hormone Alias: T3 Na; Triostat; L-Triiodothyronine T3; Liothyronine Sodium Salt; T3 Sodium Salt; Tertroxin; Thyroid hormone; Cynomel; Cytomel sodium; Liothyronine Sodium; ...

Global chemicals Co.,Ltd
Verified Supplier

Quality Veterinary Drug Pharmaceutical Raw Materials Of Tetracycline Hydrochloride 64-75-5 for sale

Brand Name:dingsheng

Model Number:64-75-5

Place of Origin:China

Veterinary Drug Pharmaceutical Raw Materials Of Tetracycline Hydrochloride 64-75-5 Product Name:Tetracycline hydrochloride,Sumycin Tetracycline hydrochloride CAS NO.:64-75-5 Tetracycline hydrochloride EINECS:200-593-8 Tetracycline hydrochloride Molecular ...

Shandong Chuangrui Chemical Technology Co., Ltd.
Verified Supplier

Shandong

Quality buy melanotan 2 |  Peptide - Forever-Inject.cc Online Store | 10mg/vial | CAS Number : 121062-08-6 for sale

Place of Origin:China

Brand Name:Forever-Inject.cc

Model Number:10mg/vial

... mass and reduce food intake. 3 Induces skin tanning at low doses. 4 Potent self-tanner applications. Online store : Forever-inject.cc Product name Unit Size Image CJC-1295 2mg CJC-1295 dac...

ForeverInject International Holdings CO. Limited
Site Member

Zhejiang

Quality Sermorelin Aceta CAS 86168-78-7 For Body Building & Fat Loss Growth Hormone Raw Powder With 99% Purity for sale

Brand Name:shucan

Model Number:86168-78-7

Place of Origin:SHANGHAI

... Building & Fat Loss Growth Hormone Raw Powder With 99% Purity Quick Details: Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS...

ShangHai ShuCan industrial co.. LTD
Active Member

Shanghai

Quality Sermorelin Acetate Hydrate Increase Human Growth Hormone In Sport GHRH for sale

Brand Name:KANGDISEN

Model Number:2 mg/vial

Place of Origin:China

... Sport GHRH Sermorelin Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRP) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was...

Hongkong Kangdisen Medical Co., Limited
Site Member

Hong Kong

Quality Legal Yellow Oily Liquid Rippex 225mg / Ml Anabolic Steroid Injections Muscle Mass Sale Online for sale

Brand Name:HKYC

Model Number:Rippex 225

Place of Origin:China

...Legal Yellow Oily Liquid Rippex 225mg / Ml Anabolic Steroid Injections Muscle Mass Sale Online Rippex 225 Introduction: This is a powerful anabolic agent with very strong androgenic properties, providing you ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Active Member

Hong Kong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request