| Sign In | Join Free | My benadorassociates.com |
|
All 60cm reusable noise cancelling ear plugs wholesalers & 60cm reusable noise cancelling ear plugs manufacturers come from members. We doesn't provide 60cm reusable noise cancelling ear plugs products or service, please contact them directly and verify their companies info carefully.
| Total 25 products from 60cm reusable noise cancelling ear plugs Manufactures & Suppliers |
|
|
|
Brand Name:Futuretech Model Number:FTFE-02 Place of Origin:Shenzhen ... to break, reusable and can be cleaned. 6 Colors: The package contains 30 pairs of corded ear plugs in various colors including light blue, black, pink, green, orange and yellow, enough for your daily use; The cord is approx. 60 ... |
FUTURE TECH LIMITED
|
|
|
Place of Origin:Zhejiang China Brand Name:FuXing Model Number:OEM ODM ... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come with alternative sizes. A proper size forms a |
JIAXING FUXING IMP. AND EXP. CO.,LTD
Zhejiang |
|
|
Place of Origin:Changzhou, Jiangsu Brand Name:Good Job ..., it can be an ideal facility used for airplanes, swimming pools, bedrooms, self-study classrooms, factories, construction sites, urban areas, etc. The Noise Ear Plugs come with high performance PU and Plastic material, which has the advantage of |
CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Jiangsu |
|
|
Brand Name:UNIFORM Model Number:AUTC-HP-M1152 Place of Origin:CHINA ... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-... |
Anhui Uniform Trading Co.Ltd
Anhui |
|
|
Brand Name:Aonike Model Number:BT880 Place of Origin:China RGB Cute Cat Ears Bluetooth 5.0 Wireless Headphone With Microphone Noise Cancelling Girl Stereo Music Product Description Horn diameter 40mm 32 euro Sensitivity 108± 3dB Maximum power input 100mW Line length 2 m Plug 3.5 mm/USB Impedance Ω 2.2 K or less ... |
Shengpai Electronics Co,ltd
Guangdong |
|
|
Brand Name:OEM / ODM / HYQ Model Number:SY1027 Place of Origin:China ...Ear Earphones 22Ω Durable Cord Wired Noise Cancelling Earbuds 3.5mm Wired Earphones In-Ear Headphone Colorful Earbuds Dynamic 10mm Speaker Earphone Prodctus Specification Style Number SY1027 Wire Material PVC Speaker Φ10MM Jack Type 3.5mm Cable Length 120cm Track System Stereo Frequency range 20Hz-20KHz Impedance 22Ω±5Ω Sensitivity 90dB±5dB Max power input 10mW Plug 3.5mm Plug... |
Guangzhou Huayi Electronic Factory
Guangdong |
|
|
Brand Name:onikuma Model Number:k1b Place of Origin:China ... Switch , PC , Nintendo 3DS , Laptop , PSP , Tablet , iPad , Computer , Mobile Phone . 【HD Crystal Stereo Surround & Noise Cancelling】- Perfectly reducing background noise by all-inclusive PU leather earmuffs to enjoy each 3D loud explosion and |
Shenzhen Ouni Technology Co.,Ltd
|
|
|
Brand Name:EARLISTEN Model Number:HEADPHONE Place of Origin:CHINA ...Noise Cancelling Headphones High Elasticity Product description 1. Excellent sound quality,eco-friendly. 2. Foldable design,High-performance sound quality. 3. Quality Inspection before shipping to clients,We will supply 12 months warranty. 4. The jack plug is made of durable rubber that will withstand the wear and tear of daily listening. 5. High elastic sponge is made of the ear... |
Earlisten Electronic Co ., Ltd
Guangdong |
|
|
Brand Name:EARLISTEN Model Number:HEADPHONE Place of Origin:CHINA ...Noise Cancelling Headphones ABS / Plastic Material Cartoon Style Product description 1. 100% Brand new and high quality! 2. Soft and comfortable sleeping headband with built-in headphones 3. Headband can also be as a sleep mask as well 4. Plugs right into your iPod, MP3 Player, or capable smartphone 5. Headband can be washed after removing electronics 6. 1 YEAR LIMITED WARRANTY Specification Product Name Deep Bass Sound On-Ear |
Earlisten Electronic Co ., Ltd
Guangdong |
|
|
Brand Name:sweet Model Number:HT-034 Place of Origin:Ningbo ...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear plugs and wires can be separated Silicone material, washable reusable... |
Sweet Home International(H.K.)Limited
Zhejiang |
|
|
Brand Name:picun Model Number:ANC-02 Place of Origin:Made in China ... deep bass sound Noise reduction function can be enabled in a variety of states, including Bluetooth on or off, plug-in state Soft protein memory foam ear pads with large ear cups provide comfortable wearing Metal stretchable arm, rotatable and foldable, |
Golden Promise Industrial Mfg.Co.,Ltd.
|
|
|
Brand Name:AKE Model Number:D4 Place of Origin:CHINA Earphone Eerbuds USB TYPE C Earpiece + Mic Volume Control For Xiao mi Huawei Mate 10 Mate 10 Pro P20 P20 Pro Style wholesale mobile type c plug in-ear earphone 120cm high quality wired type-c earbuds with mic and Volume Control logo customized for xiaomi/... |
AKE Technology Ltd
|
|
|
Brand Name:DL Model Number:DL-G100Pro Place of Origin:CHINA 7.1 Sound Headsets USB Plug Noise Canceling Easy Control With Microphone Features: ♫【Comfortable Ergonomically Desigh】 Big and soft over-ear pads provide excellent durability and long-time wearing comfy. The skin-friendly leather material of the ... |
DL ELECTRONICS CO.,LTD
|
|
|
Brand Name:OEM Model Number:OEM Place of Origin:CHINA ...Noise Prevention Reusable Noise-Reducing Silicone Earplugs Product Description Advantage 1. Each pairs of earplugs is independent to store in a carry case,convenient carring and saving at anywhere 2. Reusable Ear plugs easy to distinguish and enough for all family or gift friends. 3. Soft TPR materials for unparalleled comfort: these noise... |
Xiamen Juguangli Import & Export Co., Ltd
Fujian |
|
|
Brand Name:Artshow Model Number:AEP-6132 Place of Origin:China Wired Earphones Ergonomic Wired Earphones In-Ear Earphone With Soft Silicon Earbuds With Microphone Black For Music And Computer Gaming Product Description Article No.: AEP-6132 Speaker Φ10mm Frequency Response 20hz-20khz Cable Length 1.2M Plug type Φ3.5mm... |
Anhui Arts & Crafts Import & Export Company Ltd.
Anhui |
|
|
Brand Name:Tianmingwei Model Number:TCE02 Place of Origin:CHINA Product Description Single Earphone with Microphone ,3.5mm Earbud One Side Metal Noise Isolating Earplugs, Spring Coil Reinforced Cord 1,This earphone has a 4-conductor plug and the built-in microphone makes this a headset earphone that is iPhone ... |
Guangzhou Tianmingwei Electronics Technology Co,ltd
Guangdong |
|
|
Place of Origin:China Brand Name:OEM/ODM Model Number:MO-EE001 Detailed product specification: Style: Simple Type Earphone Materials: ABS Suit For: MP3/MP4/PC Communication: Wired Power Capability: 1000mw Color: White Specifications: Model MO-EE001 Speaker 15mm Sensitivity 102Db S.P.L at 1khz Impedance 32ohms ... |
Dong Guan Dragon Label Co., Limited
Guangdong |
|
|
Brand Name:Cree Model Number:EP0001 Place of Origin:China Ear Cushions Ear Pads Foam Headphone Earpads Fit For Bose QC2 QC15 QC25 QC35 Essential details Communication: Wired Function: Noise Cancelling Style: In-ear Volume Control: No Waterproof Standard: IPX-4 Place of Origin: China Vocalism Principle: Other ... |
Dongguan Kerui Automation Technology Co., Ltd
Guangdong |