foam ear plugs 23 6inch

Brand Name:Futuretech

Model Number:FTFE-02

Place of Origin:Shenzhen

... to break, reusable and can be cleaned. 6 Colors: The package contains 30 pairs of corded ear plugs in various colors including light blue, black, pink, green, orange and yellow, enough for your daily use; The cord is approx. 60 cm/ 23.6 inches in length.

Place of Origin:Zhejiang China

Brand Name:FuXing

Model Number:OEM ODM

...Foam Disposable Earplugs Slow Rebounded Soft Ear Plugs Non-toxic & Slow Rebound Material: Made of Super Soft and Non-toxic PU Foam (Latex free and PVC free); Slow rebound foam material fits different ear canal structures and have no pressure on ear High Noise Reduction: 38dB SNR (Single Number Rating) and 31dB NRR (Noise Reduction Rating) - They are two different rating systems; High noise reduction rate ear plugs...

Place of Origin:yangzhou

Brand Name:Xinfly

Specifications -Foam earplug or silicone earplug -Metal tube with key ring,ball chain or hook. -Colour depends on need -Logo print is ok Description for earplug with metal tube: - Earplugs: PU foam earplug or silicone earplug with cord or without cord - ...

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-...

Place of Origin:China

Brand Name:DISHINE

Pu Foam Ear Plugs 【Description】 Sound insulation is made of PU foam, which is easy to put into your ear to keep away the noise. Each pair is packed with a easy-open plastic case. Your logo can be added on the case. Several colors are available. Pricing...

Place of Origin:Guangdong, China

Model Number:XT-EY008

Hot Selling Comfortable Luxury Fashion Memory Foam Sleeping Covers 3D lint free eye patch with Ear Plugs Product Description eye mask Item: sleeping eye mask Material: 3D memory foam Size: 23*8.5cm or customized Color: Customized any color MOQ: 3000pcs ...

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

Description 100% PVC-Free, slow rebound, various rebound time are welcomed Our foam earplugs are made of extra-soft, lightweight foam that seals the ear canal without pressure, tensile, disposable Bullet shape for a snug fit while gently conforming to the ...

Brand Name:D-Jeesian

Model Number:H09-FEM19009

Place of Origin:GuangDong/China

1, Product Name: Sleep Eye Mask Cover with Ear Plugs, Light Blocking Memory Foam Eye Mask with Adjustable Strap for Sleeping/Shift Work ★ ELIMINATE EYE FATIGUE: Unique contoured eliminate eye fatigue, which has ZERO pressure to eyes, promoting REM sleep. ...

Brand Name:SAFEYEAR

Model Number:E-1013

Place of Origin:CHINA

E-1013 Bullet Type Earplug For Good Sleeping Soft Resilient Material * Use: Improve sleep, concentrate on the spirit, protect hearing, etc. * Place: Can be used in homes, dormitories, classrooms, construction sites, factories and other places. * Efficacy: ...

Brand Name:BSL

Model Number:SLE-EY2 (CPE)

Place of Origin:CHINA

Material: PE CE/ ANSI Quality: high quality Color: red CE: SNR: 27db Packing: plastic bag with card 50pcs/ctn 13/11kgs 51x30x49cm 19000 pcs/20’

Brand Name:Amydi-med or Customized

Model Number:AMD-DP-EC0007-X

Place of Origin:China

...Ear Canal Foam Skin Temperature Probe Skin Temperature Probe Quick Details: Product Name: Skin Temperature Probe Model no.: AMD-DP-EC0007-X Compatible brand : VR medical (thin)2.25K Plug: VR 2Pin Cable color: White cable Cable material: PVC, Probe material: Foam...

Brand Name:DL

Model Number:DL-G19

Place of Origin:CHINA

...Ear Headphone With Mic-Mute For PC Features: ♫【Humanized Design& Comfortable for Wearing】Easy to control the button of Mute and the flexible mic of the headset at any time without disturbing your gaming. Superior comfortable memory foam and good air permeability over-ear adjustable pads can reduce hearing impairment and heat sweat for long time wearing ♫【Fancy Led Light】Plug...

Place of Origin:China

Brand Name:OEM

Model Number:MPO fiber distribution frame

Product display CY’s High Density (HD) Series patch panels offer an extra slot that accepts up to four adapter panels or MPO cassettes in the 1RU footprint. This design has been accomplished by staggering the mounting ears. The HD patch panels are ideal...

Brand Name:Artshow

Model Number:AHP-23-SH-A60

Place of Origin:China

... Cancelling Mic- Soft Foam Ear Pads RGB Lights for PC/Xbox One/Switch/Laptops Product Description Article No.: AHP-23-SH-A60 USB Pro Gaming Headset for PC - Perfect Surround Sound Headphones with Noise Cancelling Mic- Soft Foam Ear Pads RGB Lights for ...

Brand Name:picun

Model Number:ANC-02

Place of Origin:Made in China

... deep bass sound Noise reduction function can be enabled in a variety of states, including Bluetooth on or off, plug-in state Soft protein memory foam ear pads with large ear cups provide comfortable wearing Metal stretchable arm, rotatable and foldable,

Brand Name:Customized

Model Number:None

Place of Origin:China

Emoji Cute Smiley Face Dry Eraser Blackboard Whitebaord Eraser Felt Foam Dry Eraser Item Magnetic EVA eraser whiteboard eraser Materials: EVA,sponge, magnet shape Cartoon emoji shape or customized size 2*2*0.6inch Color CMYK usage Clean Whiteboard, ...