Sign In | Join Free | My benadorassociates.com
benadorassociates.com
Products
Search by Category

foam noise reduction

All foam noise reduction wholesalers & foam noise reduction manufacturers come from members. We doesn't provide foam noise reduction products or service, please contact them directly and verify their companies info carefully.

Total 7156 products from foam noise reduction Manufactures & Suppliers
Quality Energy Saving Construction Heat Insulation Foam Noise Reduction Anti Condensation for sale

Brand Name:CYG

Model Number:NON

Place of Origin:Guangdong, China (Mainland)

reflecting fireproof sound and heat insulation sheet materials ixpe foam for roof Closed Cell Cross Linked Rolls & Laminated Sheets Rolls, sheets and multi-layer laminated blocks manufactured from cross linked closed cell PE foam exhibit all the attributes...

Cyg Tefa Co., Ltd.
Verified Supplier

Guangdong

Quality Rogers L-32 Foam Waterproof Flame Retardant Noise Reduction Polyurethane Foam for sale

Brand Name:Rogers

Model Number:L-32

Place of Origin:China

...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product ...

SZ PUFENG PACKING MATERIAL LIMITED
Verified Supplier

Guangdong

Quality 33kg/M3 2mm Laminate Underlay 200sqft/Roll Floor Impact Noise Reduction Underlayment for sale

Brand Name:new top star

Model Number:IXPE3030-4

Place of Origin:china

...Foam Underlay 200sqft/roll Noise Reduction Underlayment The Green IXPE foam flooring underlayment is 2mm thick and will provide you with the best performance of moisture barrier protection AND sound reduction to keep your floors free of squeaks! The 40microns membrane will protect your floors from moisture rising from your subfloor. 3 in 1 IXPE foam...

Changzhou New Top Star New Material Technology Co.,Ltd
Verified Supplier

Quality Blue IXPE 2mm Foam Underlay Noise Reduction Underlay For Wood Floor for sale

Brand Name:No Brand

Model Number:30IXPE 20

Place of Origin:China

...IXPE Foam For Wood Floor Comfort Step And Noise Reduction Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and controllable expansion ratio. The lifespan of IXPE is also significantly longer than traditional PE foam. As...

Jiangsu Zhongxinhe New Material Technology Co., Ltd.
Site Member

Jiangsu

Quality Noise Reduction Foamed Rubber Sheet Insulation Boards 1000mm 1200mm for sale

Brand Name:HaiKe

Model Number:HK95020

Place of Origin:Chongqing China

Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ...

Chongqing Haike Thermal Insulation Material Co., Ltd.
Active Member

Chongqing

Quality Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones for sale

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Active Member

Guangdong

Quality Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones for sale

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Verified Supplier

Guangdong

Quality Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs for sale

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ...

Anhui Uniform Trading Co.Ltd
Verified Supplier

Anhui

Quality 77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor for sale

Categories:Aluminum Roller Shutter Door

Country/Region:china

Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam...

Starking Shutter Manufacturer Limited
Verified Supplier

Quality NOISE REDUCTION HEADPHONE #ANC-J3 for sale

Place of Origin:China

Model Number:#ANC-J3

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal state (without battery) ,it was easy to switch. 5

Shenzhen Bowei Electronics Co.,Ltd.
Active Member

Guangdong

Quality Self Adhesive Rubber Weather Stripping Noise Reduction Epdm Foam Strip for sale

Brand Name:JYD

Model Number:custom made

Place of Origin:China

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through...

Sichuan Jiayueda Building Materials Co., Ltd.
Site Member

Sichuan

Quality FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design for sale

Brand Name:Future Tech

Model Number:FT-EM5002

Place of Origin:Shenzhen China

...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam...

FUTURE TECH LIMITED
Verified Supplier

Quality Construction Site Safety Soft Ear Plugs Flexible Maximum Noise Reduction for sale

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound time are welcomed. Our foam earplugs are made of

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Active Member

Jiangsu

Quality Professional Noise Reduction Fence Soundproof Material Aluminum Sheet Metal for sale

Brand Name:TC

Model Number:TCNB

Place of Origin:China

... reduction of roads, highways, elevated composite roads and other noise sources. It is divided into a purely sound-reflecting reflective sound barrier, and a composite sound barrier combined with sound absorption and sound ...

Qingdao TaiCheng transportation facilities Co.,Ltd.
Verified Supplier

Shandong

Quality Wireless Bass Bluetooth Headset Active Noise Reduction Headphones For Gaming Phone for sale

Brand Name:Aonike

Model Number:BT800

Place of Origin:China

... Noise Reduction Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep Bass *Product Description Type: Active Noise Cancelling Chipset: TI (Texas Instruments) Noise reduction ...

Shengpai Electronics Co,ltd
Active Member

Guangdong

Quality Industrial Rubber Foam Sheet Pipe Manufacturing Line for Noise Reduction and Vibration Absorption for sale

Brand Name:huashida

Place of Origin:Qingdao, China

Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam insulation materials (commonly known as "sponge pipes" or "rubber-...

Qingdao Huashida Machinery Co., Ltd.
Verified Supplier

Shandong

Quality Split Audiophile Bluetooth Earbuds Noise Reduction Ipx5 Waterproof for sale

Brand Name:Artshow

Model Number:B09

Place of Origin:China

... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active noise reduction Features Immersive sound Premium speaker drivers deliver crisp, dynamic audio. Active Noise Reduction Technology and sealed in-ear design limits background noise.

Anhui Arts & Crafts Import & Export Company Ltd.
Verified Supplier

Anhui

Quality Wearproof Noise Reduction CR Sealed Foam For Mop Making for sale

Brand Name:HONTECK

Model Number:CR0515B

Place of Origin:China

CR Sealed Foam CR0515B Heat-Resistant And Fire Resistant For Civil Engineering Product introduction CR rubber and plastic products are new environment-friendly plastic foam materials 1,introduce CR rubber and plastic products are new environment-friendly ...

Kunshan Honteck Electronic Material Co., Ltd
Active Member

Jiangsu

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
Submit Buying Request