| Sign In | Join Free | My benadorassociates.com |
|
All foam noise reduction wholesalers & foam noise reduction manufacturers come from members. We doesn't provide foam noise reduction products or service, please contact them directly and verify their companies info carefully.
| Total 7872 products from foam noise reduction Manufactures & Suppliers |
|
|
|
Brand Name:CYG Model Number:NON Place of Origin:Guangdong, China (Mainland) reflecting fireproof sound and heat insulation sheet materials ixpe foam for roof Closed Cell Cross Linked Rolls & Laminated Sheets Rolls, sheets and multi-layer laminated blocks manufactured from cross linked closed cell PE foam exhibit all the attributes... |
Cyg Tefa Co., Ltd.
Guangdong |
|
|
Brand Name:Rogers Model Number:L-32 Place of Origin:China ...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product ... |
SZ PUFENG PACKING MATERIAL LIMITED
Guangdong |
|
|
Brand Name:new top star Model Number:IXPE3030-4 Place of Origin:china ...Foam Underlay 200sqft/roll Noise Reduction Underlayment The Green IXPE foam flooring underlayment is 2mm thick and will provide you with the best performance of moisture barrier protection AND sound reduction to keep your floors free of squeaks! The 40microns membrane will protect your floors from moisture rising from your subfloor. 3 in 1 IXPE foam... |
Changzhou New Top Star New Material Technology Co.,Ltd
|
|
|
Brand Name:No Brand Model Number:30IXPE 20 Place of Origin:China ...IXPE Foam For Wood Floor Comfort Step And Noise Reduction Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and controllable expansion ratio. The lifespan of IXPE is also significantly longer than traditional PE foam. As... |
Jiangsu Zhongxinhe New Material Technology Co., Ltd.
Jiangsu |
|
|
Brand Name:HaiKe Model Number:HK95020 Place of Origin:Chongqing China Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ... |
Chongqing Haike Thermal Insulation Material Co., Ltd.
Chongqing |
|
|
Brand Name:EARLISTEN Model Number:HEADPHONE Place of Origin:CHINA ...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6. |
Earlisten Electronic Co ., Ltd
Guangdong |
|
|
Brand Name:EARLISTEN Model Number:HEADPHONE Place of Origin:CHINA ...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6. |
Earlisten Electronic Co ., Ltd
Guangdong |
|
|
Brand Name:UNIFORM Model Number:AUTC-HP-M1152 Place of Origin:CHINA ... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ... |
Anhui Uniform Trading Co.Ltd
Anhui |
|
|
Categories:Aluminum Roller Shutter Door Country/Region:china Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam... |
Starking Shutter Manufacturer Limited
|
|
|
Place of Origin:China Model Number:#ANC-J3 ... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal state (without battery) ,it was easy to switch. 5 |
Shenzhen Bowei Electronics Co.,Ltd.
Guangdong |
|
|
Brand Name:JYD Model Number:custom made Place of Origin:China ... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through... |
Sichuan Jiayueda Building Materials Co., Ltd.
Sichuan |
|
|
Brand Name:Future Tech Model Number:FT-EM5002 Place of Origin:Shenzhen China ...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam... |
FUTURE TECH LIMITED
|
|
|
Place of Origin:Changzhou, Jiangsu Brand Name:Good Job ... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound time are welcomed. Our foam earplugs are made of |
CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Jiangsu |
|
|
Brand Name:Aonike Model Number:BT800 Place of Origin:China ... Noise Reduction Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep Bass *Product Description Type: Active Noise Cancelling Chipset: TI (Texas Instruments) Noise reduction ... |
Shengpai Electronics Co,ltd
Guangdong |
|
|
Brand Name:huashida Place of Origin:Qingdao, China Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam insulation materials (commonly known as "sponge pipes" or "rubber-... |
Qingdao Huashida Machinery Co., Ltd.
Shandong |
|
|
Brand Name:Artshow Model Number:B09 Place of Origin:China ... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active noise reduction Features Immersive sound Premium speaker drivers deliver crisp, dynamic audio. Active Noise Reduction Technology and sealed in-ear design limits background noise. |
Anhui Arts & Crafts Import & Export Company Ltd.
Anhui |
|
|
Brand Name:HONTECK Model Number:CR0515B Place of Origin:China CR Sealed Foam CR0515B Heat-Resistant And Fire Resistant For Civil Engineering Product introduction CR rubber and plastic products are new environment-friendly plastic foam materials 1,introduce CR rubber and plastic products are new environment-friendly ... |
Kunshan Honteck Electronic Material Co., Ltd
Jiangsu |
|
|
Brand Name:Soungwo Model Number:S86 Place of Origin:Shenzhen, China ... earphones noise reduction double wireless charging no delay About this item: ANC Noise Reduction The earphone design completely fits the ear, isolating most of the noise from the outside. With ANC active noise reduction, the noise reduction can reaches 32... |
Shenzhen WEE Electronic CO.,LTD
Guangdong |