noise reduction foam

Brand Name:HaiKe

Model Number:HK95020

Place of Origin:Chongqing China

Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ...

Place of Origin:guangzhou

Brand Name:JFZ

Product Details Using a combination of various inorganic materials, with inorganic materials as the main material, a special board is made by adding conductive materials such as conductive porcelain clay powder and conductive mica powder, reinforcing ...

Brand Name:Rogers

Model Number:L-32

Place of Origin:China

...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product ...

Brand Name:CTF

Model Number:TGD 3510 PO

Place of Origin:China

... 3510 PO Foam) is a foam product obtained through the processes of blending polyethylene with foaming agents and auxiliaries, followed by extrusion and foaming. Further processing includes laminating with aluminum film and adhesive backing to produce the

Brand Name:Futuretech

Model Number:FTFE-04

Place of Origin:Shenzhen

... Silicone Foam Ear Plugs 31.5 X 12.5mm With Nylon PVC Cord Product Overview Safety silicone earplugs with nylon or PVC cord for superior ear protection in various environments. Key Features Perfect Noise Reduction Provides maximum noise reduction (NRR 25dB...

Model Number:Z-Foam800-10SEC

Brand Name:Ziitek

Place of Origin:China

...Foam Gasket With High Compression And Creep Resistance Ideal For Cushioning And Noise Reduction Applications Product Overview Z-Foam ®800-10SEC Series combines the inherent advantages of silicone polymer, including high/low temperature resistance, UV/ozone resistance, weatherability, electrical insulation, and environmental safety. With the lightweight, acoustic damping, and vibration-damping properties of foam...

Place of Origin:Qingdao, China

Brand Name:huashida

...Foam Sheet Pipe Manufacturing Line for Noise Reduction and Vibration Absorption Product Overview Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam...

Brand Name:new top star

Model Number:IXPE3030-4

Place of Origin:china

...Foam Underlay 200sqft/roll Noise Reduction Underlayment The Green IXPE foam flooring underlayment is 2mm thick and will provide you with the best performance of moisture barrier protection AND sound reduction to keep your floors free of squeaks! The 40microns membrane will protect your floors from moisture rising from your subfloor. 3 in 1 IXPE foam...

Model Number:SR

Brand Name:SR

Place of Origin:CHINA

... comfort, and provide moisture protection for various flooring systems. Manufactured from premium Ethylene Vinyl Acetate (EVA) foam, this flooring underlay offers excellent elasticity, shock absorption, sound insulation, and durability. This product is

Brand Name:No Brand

Model Number:30IXPE 20

Place of Origin:China

...IXPE Foam For Wood Floor Comfort Step And Noise Reduction Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and controllable expansion ratio. The lifespan of IXPE is also significantly longer than traditional PE foam. As...

Place of Origin:Zhejiang China

Brand Name:FuXing

Model Number:OEM ODM

...Foam Disposable Earplugs Slow Rebounded Soft Ear Plugs Non-toxic & Slow Rebound Material: Made of Super Soft and Non-toxic PU Foam (Latex free and PVC free); Slow rebound foam material fits different ear canal structures and have no pressure on ear High Noise Reduction: 38dB SNR (Single Number Rating) and 31dB NRR (Noise Reduction Rating) - They are two different rating systems; High noise reduction rate ear plugs can meet the needs of noise

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Place of Origin:Qingdao, China

Brand Name:Xinmei

... noise knife cutting pulverizer This machine is mainly used for crushing sponges, cloth sponges, pea, EVA, plastics and rubber. It can be used with sponge regeneration equipment. Tdp-s-4 crusher is equipped with sound insulation and noise reduction device.

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ...

Brand Name:JIRUI

Model Number:CX0042

Place of Origin:CHINA

...vehicle, such as the doors, floor, roof, and firewall. Their strategic placement and combination can effectively minimize noise and improve overall comfort. 2,MPV cars are often used for family outings or group travel, and a quiet interior is essential for

Categories:Aluminum Roller Shutter Door

Country/Region:china

Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam...

Place of Origin:China

Model Number:#ANC-J3

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal state (without battery) ,it was easy to switch. 5

Brand Name:JYD

Model Number:custom made

Place of Origin:China

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through...