| Sign In | Join Free | My benadorassociates.com |
|
All noise reduction ear protection wholesalers & noise reduction ear protection manufacturers come from members. We doesn't provide noise reduction ear protection products or service, please contact them directly and verify their companies info carefully.
| Total 23282 products from noise reduction ear protection Manufactures & Suppliers |
|
|
|
Place of Origin:Zhejiang China Brand Name:FuXing Model Number:OEM ODM ... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come with alternative sizes. A proper size forms a |
JIAXING FUXING IMP. AND EXP. CO.,LTD
Zhejiang |
|
|
Brand Name:Future Tech Model Number:FT0014 Place of Origin:Shenzhen China ...Protection of the Ear Muffs ANSI specification Description of Electronic Ear Muffs : ①Fit to ear Human body leather material, comfortable experience,reduce pressure on the ear,fit the face. ② Comfortable to wear Simple and fashionable wear,seismic fiber material,good elasticity,strong pedestrian use for a long time. ③ Good protection... |
FUTURE TECH LIMITED
|
|
|
Brand Name:PDC Model Number:PDC139 Place of Origin:China Product Description Product name Wired Over Ear gaming Headphone Noise reduction ear pads and DC jack USB connector for PS4 Material ABS, Aluminium or customized material. Color refer to the pictures in site or customized color MOQ 3000 pieces Price EX ... |
Producentre (Dongguan) Electronic Co., Ltd
Guangdong |
|
|
Brand Name:WL ...Noise Reduction Fire Protection Wall Panel Pet Felt 100% Polyester Fibre Acoustic Panel Product type Polyester fiber panel/PET sound absorbing panel Product specification Chromatic PET panels:1220*2420*9/12mm;High density fiber panels:2500/3000*1210*5/9mm Structure Made of high-quality fiber and covered with sound-permeable fabric finish Density 100~600kg/m3 Acoustics Noise reduction coefficient nRC 0.75 Fire protection... |
Chengdu Yixing Amber Decoration Design Co., Ltd.
Sichuan |
|
|
Place of Origin:Changzhou, Jiangsu Brand Name:Good Job ..., it can be an ideal facility used for airplanes, swimming pools, bedrooms, self-study classrooms, factories, construction sites, urban areas, etc. The Noise Ear Plugs come with high performance PU and Plastic material, which has the advantage of |
CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Jiangsu |
|
|
Adjustable Height Plastic Bracket Polycarbonate PC Sheet Canopy With Noise Reduction Rain ProtectionBrand Name:TOPPC Model Number:TOPPC21 Place of Origin:China ...both plastic and aluminum, manufactured by our trusted Aluminum bracket factory to ensure the highest quality and durability. In addition to sun and rain protection, our DIY PC Canopy also has the added feature of reducing noise. This makes it the perfect |
Foshan Huaxia Nature Building Materials Co., Ltd.
Guangdong |
|
|
Brand Name:Yihong Model Number:0628 Place of Origin:Guangdong Dongguan Company Profile *, *::before, *::after {box-sizing: border-box;}* {margin: 0;}html, body {height: 100%;}body {line-height: 1.5;-webkit-font-smoothing: antialiased;}img, picture, video, canvas, svg {display: block;max-width: 100%;}input, button, textarea, ... |
Dongguan Yihong Adhesive Technology Co., Ltd.
Guangdong |
|
|
Brand Name:UNIFORM Model Number:AUTC-HP-M1152 Place of Origin:CHINA ... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-HP-... |
Anhui Uniform Trading Co.Ltd
Anhui |
|
|
Brand Name:HONY Model Number:Earmuffs Place of Origin:Guangdong China ...noise reduction earmuffs, match the bluetooth music glasses are perfect group. When you listening to music, wear the noise reduction earmuffs, you will get music much more surround sound. It is perfect choice if you are at Station, shopping mall, subway or |
Shenzhen HONY Optical Co., Limited
Guangdong |
|
|
Brand Name:Vizz/ Retorz/ OEM Model Number:RT- V40 Place of Origin:China ..., TWS smart headphones will play an important role in the fields of wireless connection, voice interaction, intelligent noise reduction, health monitoring, and hearing enhancement/protection. It is not only a standard configuration of smart phones, |
Shenzhen Hosing Technology Development Co., Ltd.
Guangdong |
|
|
Brand Name:sweet Model Number:HT-034 Place of Origin:Ningbo ...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear... |
Sweet Home International(H.K.)Limited
Zhejiang |
|
|
Brand Name:Cree Place of Origin:Guangdong, China ...Noise Reduction Product Description: Headphone Earpads provide excellent noise reduction and comfort for users. It comes with multi-color choice, such as black, to fit with different preferences. The round shape is designed for a snug fit and breathability, and can also be customized for brands. With advanced noise reduction... |
Dongguan Kerui Automation Technology Co., Ltd
Guangdong |
|
|
Place of Origin:Zhejiang, China Brand Name:WELWORK Model Number:EM123 ... filter Earmuff NRR 31dB Size suit for adlut,easy to adjust Color Black,red,blue or others Function Reduce the noise to protect the ear MOQ 1000PCS Production capacity 100000pcs/month Packing one pc per polybag,50pcs per carton Terms of Payment T/T Port of |
Ningbo Welwork Ppe Co., Ltd.
Zhejiang |
|
|
Brand Name:EARLISTEN Model Number:HEADPHONE Place of Origin:CHINA ...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6. |
Earlisten Electronic Co ., Ltd
Guangdong |
|
|
Brand Name:EARLISTEN Model Number:HEADPHONE Place of Origin:CHINA ...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6. |
Earlisten Electronic Co ., Ltd
Guangdong |
|
|
Brand Name:OEM Model Number:XY-50-1 Place of Origin:Guangdong,China ... XY-50 TWS bluetooth earphone with charge case ear sensor earbuds bluetooth 3 pairs free ear tips freebuds ANC tws earbuds With a noise reduction depth of -28DB, it cut out the lower frequency noises like trains,bus,busy srteetts and so on,makes you focus... |
SoKe Electronic Co.,Ltd
Guangdong |
|
|
Brand Name:Artshow Model Number:B09 Place of Origin:China ... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active noise reduction Features Immersive sound Premium speaker drivers deliver crisp, dynamic audio. Active Noise Reduction Technology and sealed in-ear design limits background noise. |
Anhui Arts & Crafts Import & Export Company Ltd.
Anhui |
|
|
Brand Name:Retone Model Number:K419 Place of Origin:Shenzhen, China ...Noise Reduction Super Effective Hearing Assist - Ideal for most mild to moderate hearing loss. With noise reduction, these small devices will bring you back in the clear world. Completely-in-Canal - Very small and lightweight, no burden for ears for long time using. Great for people wearing glasses or masks. State of the Art Design - Blue device for left ear, red device for right ear... |
Retone shenzhen Technology Co., Ltd.
|
|
|
Brand Name:OEM/ODM Model Number:LD-WBE025 Place of Origin:China ... Earphones HiFi Stereo In Ear Headphone ENC ANC Call Noise Reduction Audio Buds Feature: Product Name: Wireless Earbuds Bluetooth XY-70 [Bluetooth Version] Bluetooth 5.1 [Charging compartment battery] 400mah (with protective plate) [Speaker] F10mm ... |
Shenzhen Landeal Electric Limited
|